PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 633aa    MW: 70282.6 Da    PI: 6.1454
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591866.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.21.5e-3056140187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+++e+laL+++r+em++++r++ lk+plWe+vs+k+ e g++rs+k+Ckek+en++k+yk++ke++++r++++   +++f+qlea
  XP_013591866.1  56 RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENVQKYYKRTKETRGGRHDGK--AYKFFSQLEA 140
                     8*********************************************************************86555..5******985 PP

2trihelix104.11e-32406490186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+k e+laLi++r+ me r++++  k+ lWee+s+ m++ g++r++k+Ckekwen+nk+ykk+ke++k+r +++ +tcpyf++l+
  XP_013591866.1 406 RWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKER-PQDAKTCPYFHRLD 490
                     8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.02749113IPR017877Myb-like domain
SMARTSM007170.003153115IPR001005SANT/Myb domain
CDDcd122031.37E-2755120No hitNo description
PfamPF138379.4E-2155141No hitNo description
PROSITE profilePS500906.922399463IPR017877Myb-like domain
SMARTSM007170.0045403465IPR001005SANT/Myb domain
PfamPF138377.4E-22405490No hitNo description
CDDcd122032.61E-30406470No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0042631Biological Processcellular response to water deprivation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MEQGAGGGNE VVEEASPISS RPPANMEELM RFSAAADEGG GLGGGGSSAS SSSGNRWPRE  60
ETLALLRIRS EMDSTFRDAT LKAPLWEHVS RKLLELGYKR SAKKCKEKFE NVQKYYKRTK  120
ETRGGRHDGK AYKFFSQLEA LNTTPPSSSL DATPLSVANP IQPPPSSSQF PVFPLPQTLP  180
HSVSFTPNVA PPPPPPPAPM GPTFPGVTFS SHSSSTASGM GSDDDDDEED IMDVDQAGPS  240
SRKRKRGNRG GGKMMELFDG LVRQVMQKQA SMQRSFLEAL EKREQERLHR EEAWKRQEMS  300
RLAREHEIMS QERAASASRD AAIISMIQKI TGHTIQLPPS FSSQPSPPPR QPPPAAKRPS  360
SQPVEPPQLQ PIMAIPQQQV LPPPPQPPPQ QEVTMSSDQS SPSSSRWPKA EILALINLRS  420
GMEPRYQDNV PKGLLWEEIS SSMKRMGYNR NAKRCKEKWE NINKYYKKVK ESNKERPQDA  480
KTCPYFHRLD LLYRNKVLGS GGSSSASALP HQDQISTVQK QSPVSAVKPP QGVVTVGSAS  540
SEGEEPREES PQETEKPEDL VMKELMQHQQ QDSMISEYEK IEESHNYNNM EEEEMDEELD  600
EDEKSAAYEV AFQSPANRGG NGHTEPPFLT MVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198106KRSAKKCKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00177DAPTransfer from AT1G33240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210451e-120AC021045.2 Arabidopsis thaliana chromosome I BAC T9L6 genomic sequence, complete sequence.
GenBankAC0270351e-120AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankAJ0032151e-120AJ003215.1 Arabidopsis thaliana GTL1 gene.
GenBankAY1400851e-120AY140085.1 Arabidopsis thaliana DNA-binding factor, putative (At1g33240) mRNA, complete cds.
GenBankBT0088241e-120BT008824.1 Arabidopsis thaliana At1g33240 mRNA, complete cds.
GenBankCP0026841e-120CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591866.10.0PREDICTED: trihelix transcription factor GTL1
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A0D3CS580.0A0A0D3CS58_BRAOL; Uncharacterized protein
STRINGBra040010.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.14e-90GT-2-like 1